PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00076.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 290aa    MW: 32479.1 Da    PI: 5.999
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00076.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15.1e-18222256135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C++C +tkTp+WR+gp g+ktLCnaCG+++r+ +l
  Rsa1.0_00076.1_g00007.1 222 CTHCEATKTPQWREGPCGPKTLCNACGVRFRSGRL 256
                              *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.5E-15216266IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.94E-14220279No hitNo description
PROSITE profilePS5011411.345220252IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.1E-14220253IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
CDDcd002022.53E-13222258No hitNo description
PfamPF003209.9E-16222256IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MNKGSWLPEE EEEEELKGLS DDFFDDLMNH IEEDMETAAN DDDEEEEGDW DAKFENLVPP  60
PLDVLTSFSS QFTTSHGRAS KGVQRKKPVP TLKQSSSSEV SSTIDSCLYD VKVSTLFQSS  120
NAVSVLENGS VSFQNPIQRL AFPVKGTRSK LRKRPTPPTF RSLKSFASEM VQQFASPDYD  180
SGSETYHLPS DNAPKKKRQK KNNKSDSDTP ESFNGDGTIR MCTHCEATKT PQWREGPCGP  240
KTLCNACGVR FRSGRLLPEY RPSSSPSFIP SLHSNSHRKI IEMRMKDKPG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193200PKKKRQKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636763.11e-120PREDICTED: putative GATA transcription factor 13
RefseqXP_013636764.11e-120PREDICTED: putative GATA transcription factor 13
RefseqXP_013636765.11e-120PREDICTED: putative GATA transcription factor 13
RefseqXP_013636766.11e-120PREDICTED: putative GATA transcription factor 13
RefseqXP_013744139.11e-120PREDICTED: putative GATA transcription factor 13 isoform X1
RefseqXP_013744140.11e-120PREDICTED: putative GATA transcription factor 13 isoform X2
RefseqXP_013744141.11e-120PREDICTED: putative GATA transcription factor 13 isoform X2
RefseqXP_013744142.11e-120PREDICTED: putative GATA transcription factor 13 isoform X1
SwissprotQ6DBP88e-88GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A078K3U31e-120A0A078K3U3_BRANA; BnaCnng77580D protein
TrEMBLA0A0D3C2J31e-120A0A0D3C2J3_BRAOL; Uncharacterized protein
STRINGBra035708.1-P1e-107(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.27e-60GATA transcription factor 11